PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G46130.1
Common NameATMYB48, ATMYB48-1, ATMYB48-2, ATMYB48-3, F12M12.100, MYB48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 256aa    MW: 29654.1 Da    PI: 9.1596
Description myb domain protein 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G46130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-18956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed llv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
      AT3G46130.1  9 KGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 56
                     79********************************************97 PP

2Myb_DNA-binding56.28.1e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
      AT3G46130.1  62 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 107
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.27456IPR017930Myb domain
SuperFamilySSF466893.1E-307103IPR009057Homeodomain-like
SMARTSM007175.2E-16858IPR001005SANT/Myb domain
PfamPF002499.4E-17956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-211063IPR009057Homeodomain-like
CDDcd001672.87E-111156No hitNo description
PROSITE profilePS5129427.81457111IPR017930Myb domain
SMARTSM007172.2E-1761109IPR001005SANT/Myb domain
PfamPF002492.9E-1662106IPR001005SANT/Myb domain
CDDcd001675.09E-1264107No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2464110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MMQEEGNRKG PWTEQEDILL VNFVHLFGDR RWDFIAKVSG LNRTGKSCRL RWVNYLHPGL  60
KRGKMTPQEE RLVLELHAKW GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPVSP  120
TSSFSNCSSS SVTTTTTNTQ DTSCHSRKSS GEVSFYDTGG SRSTREMNQE NEDVYSLDDI  180
WREIDHSAVN IIKPVKDIYS EQSHCLSYPN LASPSWESSL DSIWNMDADK SKISSYFAND  240
QFPFCFQHSR SPWSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2891114105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.14750.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252534_at0.0
Expression AtlasAT3G46130-
AtGenExpressAT3G46130-
ATTED-IIAT3G46130-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB48) that functions to regulate flavonol biosynthesis primarily in cotyledons.
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G46130.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G46130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727330.0AF272733.1 Arabidopsis thaliana putative transcription factor (MYB48) mRNA, complete cds.
GenBankAY5195940.0AY519594.1 Arabidopsis thaliana MYB transcription factor (At3g46130) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190199.10.0transcription factor MYB48
SwissprotQ9LX820.0MYB48_ARATH; Transcription factor MYB48
TrEMBLD7LMV91e-163D7LMV9_ARALL; Putative uncharacterized protein
STRINGAT3G46130.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Rashotte AM,Carson SD,To JP,Kieber JJ
    Expression profiling of cytokinin action in Arabidopsis.
    Plant Physiol., 2003. 132(4): p. 1998-2011
    [PMID:12913156]
  4. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  5. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  6. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]
  9. Bi YM,Wang RL,Zhu T,Rothstein SJ
    Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis.
    BMC Genomics, 2007. 8: p. 281
    [PMID:17705847]